- SYCE1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88971
- This antibody was developed against Recombinant Protein corresponding to amino acids: QQQQQKRQRL KEELEKHGMQ VPAQAQSTQE EEAGPGDVAS PKPLKGERPG AAHQAGPDVL IGQEDTLHPD LSPRGFQEIK EL
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- SYCE1
- Human
- C10orf94, CT76, POF12, SPGF15
- Unconjugated
- Rabbit
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- synaptonemal complex central element protein 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Apoptosis, Cell Biology, Cell Cycle and Replication
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVASPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKEL
Specifications/Features
Available conjugates: Unconjugated